Family Sprinkler and Landscaping

0.00/5.00 - based on 0 reviews
Write a review
Please Login or Signup to write a review

ReviewFoxy is a review website that provides a platform for customers to share their experiences and opinions about different companies and their products or services.

Family Sprinkler and Landscaping is a company listed on ReviewFoxy and its address is Aurora, CO, 80010 80010 Aurora United States.

You can write a review for Family Sprinkler and Landscaping by following these steps:

  • Go to the ReviewFoxy website
  • Search for Family Sprinkler and Landscaping using the search bar or by browsing the list of companies
  • Click on the Family Sprinkler and Landscaping profile
  • Scroll down to the review section
  • Click on the “Write a Review” button
  • Fill out the review form with your rating, title, and review content
  • Submit your review

Using the aid of the trusted site reviews and top online rating sites, your Businesses can gain fair insights into the situation. .

Yes, you need to have an account to write a review on ReviewFoxy. Having an account allows you to manage your reviews and receive notifications about your review status.

You can verify if your review has been posted by visiting the Family Sprinkler and Landscaping profile on ReviewFoxy and scrolling down to the review section. Your review should appear in the list of reviews for Family Sprinkler and Landscaping.

The time it takes for a review to be published on ReviewFoxy varies. In general, reviews are reviewed and approved within a few business days.

If you want to update or delete your review, you can do so by logging into your ReviewFoxy account and going to your review history. From there, you can edit or delete your review.

Yes, it is possible to report a review for Family Sprinkler and Landscaping as inappropriate or false on ReviewFoxy. To do so, simply contact us via support email at [email protected]. ReviewFoxy will review the reported review and take appropriate action.

Domain Registrar Information

Domain Name: FAMILYSPRINKLERANDLANDSCAPING.COM
Registrar: GoDaddy.com, LLC
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2023-11-28T13:23:14Z
Creation Date: 2019-09-13T14:50:11Z
Registry Expiry Date: 2024-09-13T14:50:11Z
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
DNSSEC: unsigned
Name Servers:
  • NS1.A2HOSTING.COM
  • NS2.A2HOSTING.COM

Embed Badge

Add to your site

Family Sprinkler and Landscaping

Description is not available for this company. You can claim this company and add your description, if you are a real owner or manager of this company.

Contact


Email Not Found
Phone Not Found
Aurora, CO, 80010 80010 Aurora United States

Note: claim ownership to update email & phone

About Reviewfoxy

ReviewFoxy is free to use, open to everybody, and built on transparency. We show reviews chronologically and encourage quality customer feedback.